Proteintech, 31791-1-AP, C3orf37 Polyclonal antibody

Size: 20ul / 150ul The C3orf37 (31791-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf37 in WB, ELISA applications with reactivity to human, mouse, rat samples 31791-1-AP targets C3orf37 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue, HEK-293T cells, MCF-7 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information HMCES, also known as C3orf37, is a protein that is associated with the protection of abasic sites. The molecular mass of HMCES is 40 kDa and it recognizes AP sites in ssDNA at replication forks and chemically modifies the lesion to generate a DNA-protein crosslink (PMID: 30554877). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36362 Product name: Recombinant human C3orf37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-300 aa of BC009993 Sequence: DTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKED Predict reactive species Full Name: chromosome 3 open reading frame 37 Observed Molecular Weight: 36 kDa GenBank Accession Number: BC009993 Gene Symbol: C3orf37 Gene ID (NCBI): 56941 RRID: AB_3670114 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96FZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.