Proteintech, 31795-1-AP, BRWD3 Polyclonal antibody

Size: 20ul / 150ul The BRWD3 (31795-1-AP) by Proteintech is a Polyclonal antibody targeting BRWD3 in WB, ELISA applications with reactivity to human samples 31795-1-AP targets BRWD3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Bromodomain and WD repeat-containing protein 3 (BRWD3) is thought to regulate gene expression through its interactions with chromatin. BRWD3 promotes the K48-linked polyubiquitination and degradation of KDM5, which depends on BRWD3 and Cul4. This function is critical for maintaining H3K4 methylation levels and regulating gene expression (PMID: 37722046). Mutations of BRWD3 are associated with a spectrum of cognitive disabilities and X-linked macrocephaly (PMID: 17668385). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36948 Product name: Recombinant human BRWD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1720-1802 aa of BC039508 Sequence: ATRAKRARIADDEFDTMFSGRFSRLPRIKTRNQGRRTVLYNDDSDNDNFVSTEDPLNLGTSRSGRVRKMTEKARVSHLMGWNY Predict reactive species Full Name: bromodomain and WD repeat domain containing 3 Calculated Molecular Weight: 204 kDa Observed Molecular Weight: 240 kDa GenBank Accession Number: BC039508 Gene Symbol: BRWD3 Gene ID (NCBI): 254065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6RI45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.