Proteintech, 31796-1-AP, LIAT1 Polyclonal antibody

Size: 20ul / 150ul The LIAT1 (31796-1-AP) by Proteintech is a Polyclonal antibody targeting LIAT1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 31796-1-AP targets LIAT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, mouse spleen tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Liat1 (Ligand of Ate1) is a protein of unknown function that was originally discovered through its interaction with arginyl tRNA protein transferase 1 (Ate1), a component of the Arg/N-degron pathway of protein degradation.Liat1 participates in Liquid-liquid phase separation (LLPS), a process which enables the temporal and spatial regulation of important cellular processes such as RNA metbolism, genome organization, DNA repair, and transcription regulation. Liat1 interacts with itself, which means Liat1 can assemble into different species in nucleus or cytosol. Our WB is consistent with Arva A et al (PMID: 33443146). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37082 Product name: Recombinant human C17orf97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-200 aa of BC141806 Sequence: GDDKHLSQSLKSQPLSSSFHDILSPCKERGPKPEHRQSKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL Predict reactive species Full Name: chromosome 17 open reading frame 97 Observed Molecular Weight: 20-70 kDa GenBank Accession Number: BC141806 Gene Symbol: C17orf97 Gene ID (NCBI): 400566 RRID: AB_3670116 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZQX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.