Proteintech, 31844-1-AP, DNLZ Polyclonal antibody

Size: 20ul / 150ul The DNLZ (31844-1-AP) by Proteintech is a Polyclonal antibody targeting DNLZ in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31844-1-AP targets DNLZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RT-4 cells Positive IHC detected in: mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DNL-type zinc finger (DNLZ, also known as HEP, ZIM17, TIMM15, and C9orf151) is a nuclear-encoded protein that is translocated to the mitochondria, thus it is located in mitochondrion and nucleoplasm (PMID: 22162012). It may function as a co-chaperone towards HSPA9/mortalin, which enhances HSPA9 solubility and stimulates HSPA9 catalytic activity (PMID: 18632665; 20392697; 21530495). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37114 Product name: Recombinant human DNLZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC146915 Sequence: MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS Predict reactive species Full Name: DNL-type zinc finger Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC146915 Gene Symbol: DNLZ Gene ID (NCBI): 728489 RRID: AB_3670126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5SXM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.