Iright
BRAND / VENDOR: Proteintech

Proteintech, 31850-1-AP, RBM27 Polyclonal antibody

CATALOG NUMBER: 31850-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBM27 (31850-1-AP) by Proteintech is a Polyclonal antibody targeting RBM27 in WB, IF/ICC, ELISA applications with reactivity to human samples 31850-1-AP targets RBM27 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Hela cell, jurkat cell, K-562 cell Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RBM27 has been identified as a candidate autism gene, and is present in cytoplasmic and and nuclear speckles. RBM27 encodes a protein containing an RNA-Binding Motif, which confers its ability to bind RNA. Therefore, RBM27 is important in mRNA processing and the turnover of nuclear polyadenylate (pA+) RNA. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35822 Product name: Recombinant human RBM27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-815 aa of NM_018989 Sequence: TLQSSAQLLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSAPSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHAGGNQSDASHLLNQSGGAGEDCQIFSTPGHPKMIYSSSNLKTPSKLCSGSKSHDVQEVLKK Predict reactive species Full Name: RNA binding motif protein 27 Calculated Molecular Weight: 119 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_018989 Gene Symbol: RBM27 Gene ID (NCBI): 54439 RRID: AB_3670129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P2N5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924