Proteintech, 31889-1-AP, CD3 epsilon Polyclonal antibody

Size: 20ul / 150ul The CD3 epsilon (31889-1-AP) by Proteintech is a Polyclonal antibody targeting CD3 epsilon in WB, IHC, ELISA applications with reactivity to rat samples 31889-1-AP targets CD3 epsilon in WB, IHC, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat thymus tissue Positive IHC detected in: rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This polyclonal antibody was raised against the epsilon chain of rat CD3 molecule. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1450 Product name: Recombinant Rat CD3 epsilon protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-103 aa of NP_001101610.2 Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY Predict reactive species Full Name: CD3 molecule, epsilon polypeptide Calculated Molecular Weight: 22kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NP_001101610.2 Gene Symbol: Cd3e Gene ID (NCBI): 315609 RRID: AB_3670133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6J423 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.