Proteintech, 31900-1-AP, KCNA6 Polyclonal antibody

Size: 20ul / 150ul The KCNA6 (31900-1-AP) by Proteintech is a Polyclonal antibody targeting KCNA6 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31900-1-AP targets KCNA6 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, Raji cells, TT cells, U2OS cells Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The Shaker-like Kv1 potassium channel family comprises 8 α subunits (Kv1.1-Kv1.8), which are key regulators of neuronal excitability in mammals (PMID: 7842011; 9581771; 22612818). Potassium voltage-gated channel subfamily A member 6 (KCNA6, also known as HBK2, Kv1.6, and PPP1R96) is a multi-pass membrane protein that is mainly expressed in the central and peripheral nervous system (PMID: 12042352; 8872310). The concentration of the Kv1.6 channel in the cell membrane can modulate the kinetic properties of Kv1.6-induced K+ current (PMID: 14575698). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35654 Product name: Recombinant human KCNA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-262 aa of NM_002235.3 Sequence: ETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDP Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, member 6 Calculated Molecular Weight: 59 kDa，529aa Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_002235.3 Gene Symbol: KCNA6 Gene ID (NCBI): 3742 RRID: AB_3670137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P17658 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.