Proteintech, 31903-1-AP, ZNF280A Polyclonal antibody

Size: 20ul / 150ul The ZNF280A (31903-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF280A in WB, ELISA applications with reactivity to human, mouse, rat samples 31903-1-AP targets ZNF280A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse adrenal gland tissue, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Zinc finger proteins are the largest transcription factor family in the human genome and play a significant role in regulating and managing gene expression, including development, differentiation, metabolism, and autophagy (PMID: 18253864; 27411336). Zinc finger protein 280A (ZNF280A, also known as SUHW1, ZNF280, and ZNF636) is a member of the zinc-finger protein family, carrying two consecutive Cys2His2 zinc finger domains (PMID: 33414445). Cys2-His2 (C2H2) zinc finger domains (ZFs) were originally identified as DNA-binding domains, and uncharacterized domains are typically assumed to function in DNA binding (PMID: 18253864). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35942 Product name: Recombinant human ZNF280A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 461-542 aa of BC053901 Sequence: LTLKEEIEHKTKDHQTFKKPEQLQGLPSETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKKTAMNTRDSRLPCSKDSS Predict reactive species Full Name: zinc finger protein 280A Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC053901 Gene Symbol: ZNF280A Gene ID (NCBI): 129025 RRID: AB_3670138 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P59817 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.