Proteintech, 31906-1-AP, TRNT1 Polyclonal antibody

Size: 20ul / 150ul The TRNT1 (31906-1-AP) by Proteintech is a Polyclonal antibody targeting TRNT1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31906-1-AP targets TRNT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information tRNA nucleotidyl transferase 1 (TRNT1, also known as CCA1, RPEM, SIFD, MtCCA, and CGI-47 ) is a cytosine-cytosine-adenine (CCA) - adding enzyme which belongs to the tRNA nucleotidyltransferase/poly (A) polymerase family. It can catalyze the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules (PMID: 27370603). Mutations in TRNT1 would cause congenital sideroblastic anemia with immunodeficiency, fevers, and developmental delay (SIFD) (PMID: 25193871). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36149 Product name: Recombinant human TRNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-405 aa of BC012537 Sequence: FKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT Predict reactive species Full Name: tRNA nucleotidyl transferase, CCA-adding, 1 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC012537 Gene Symbol: TRNT1 Gene ID (NCBI): 51095 RRID: AB_3670139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96Q11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.