Iright
BRAND / VENDOR: Proteintech

Proteintech, 31918-1-AP, TOR4A Polyclonal antibody

CATALOG NUMBER: 31918-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TOR4A (31918-1-AP) by Proteintech is a Polyclonal antibody targeting TOR4A in WB, ELISA applications with reactivity to human samples 31918-1-AP targets TOR4A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, HCT 116 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TOR4A is known to be a member of the AAA+ ATPase superfamily of proteins that are involved in the degradation of misfolded proteins via the endoplasmic reticulum-associated protein degradation (ERAD) pathway (PMID: 25873482).TOR4A is an oncogene and that DNER acts as a tumor suppressor gene by inhibiting TOR4A and its functions of promoting p-AKT and inhibiting antiapoptotic protein expression (PMID: 36204885). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36307 Product name: Recombinant human C9orf167 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of NM_017723 Sequence: MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQR Predict reactive species Full Name: chromosome 9 open reading frame 167 Calculated Molecular Weight: 46kDa Observed Molecular Weight: 38, 40 kDa GenBank Accession Number: NM_017723 Gene Symbol: C9orf167 Gene ID (NCBI): 54863 RRID: AB_3670143 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NXH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924