Proteintech, 31919-1-AP, CHD7 Polyclonal antibody

Size: 20ul / 150ul The CHD7 (31919-1-AP) by Proteintech is a Polyclonal antibody targeting CHD7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31919-1-AP targets CHD7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HuH-7 cells, Jurkat cells Positive IHC detected in: mouse cerebellum tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:750-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Chromodomain helicase DNA-binding protein 7 (CHD7) is an ATP-dependent eukaryotic chromatin remodeling enzyme that regulates nucleosome positioning and alters DNA accessibility, and is essential for organ development.CHD7 is a gene known to be associated with CHARGE syndrome, Kallmann syndrome, and hypogonadotropic hypogonadism, where it is associated with CHARGE syndrome is a congenital multiorgan disorder characterized by eye defects, heart defects, posterior nasal atresia, growth retardation, genital anomalies, ear malformations, and deafness. The effects of CHD7 mutations on inner ear development, neuronal differentiation, cardiovascular development, and regulation of bone lipid homeostasis have been studied. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36595 Product name: Recombinant human CHD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-200 aa of BC110818 Sequence: GLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMMSNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQGHPQHMQQMGSYMARGDFSM Predict reactive species Full Name: chromodomain helicase DNA binding protein 7 Observed Molecular Weight: 350 kDa GenBank Accession Number: BC110818 Gene Symbol: CHD7 Gene ID (NCBI): 55636 RRID: AB_3670144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P2D1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.