Proteintech, 31922-1-AP, CCDC167 Polyclonal antibody

Size: 20ul / 150ul The CCDC167 (31922-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC167 in WB, IF/ICC, ELISA applications with reactivity to human samples 31922-1-AP targets CCDC167 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HuH-7 cells, LNCaP cells, Raji cells, Ramos cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Coiled-coil domain (CCD) constituents are alpha-helix motifs expressed in different types of proteins, which can function in various biological processes, including cell proliferation, migration, and signal transduction (PMID: 9171830; 17428801). The coiled-coil domain containing 167 (CCDC167, also known as HSPC265 and C6orf129) is a membrane protein highly expressed in the lymph node. It is associated with immune function, which could be a therapeutic target for breast cancer and asthma (PMID: 33461170; 31821602). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37080 Product name: Recombinant human C6orf129 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC108655 Sequence: MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKN Predict reactive species Full Name: chromosome 6 open reading frame 129 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC108655 Gene Symbol: C6orf129 Gene ID (NCBI): 154467 RRID: AB_3670146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P0B6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.