Iright
BRAND / VENDOR: Proteintech

Proteintech, 31923-1-AP, HDGFL1 Polyclonal antibody

CATALOG NUMBER: 31923-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HDGFL1 (31923-1-AP) by Proteintech is a Polyclonal antibody targeting HDGFL1 in WB, ELISA applications with reactivity to human samples 31923-1-AP targets HDGFL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Hepatoma-derived growth factor-like 1 (HDGFL1, also known as HRP-1, PWWP1, and Hdgfrp1) is a member of the hepatoma-derived growth factor (HDGF) family related to tumorigenesis and the development of cancer (PMID: 18823380;  20509080). It is specifically expressed in the testis and activated in the nucleus (PMID: 22217008). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36944 Product name: Recombinant human HDGFL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-251 aa of NM_138574 Sequence: GSGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEEEKGPLKRSAGDPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVAVENGSAPSEPGLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDSL Predict reactive species Full Name: hepatoma derived growth factor-like 1 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_138574 Gene Symbol: HDGFL1 Gene ID (NCBI): 154150 RRID: AB_3670147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5TGJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924