Proteintech, 31924-1-AP, ATL1 Polyclonal antibody

Size: 20ul / 150ul The ATL1 (31924-1-AP) by Proteintech is a Polyclonal antibody targeting ATL1 in WB, ELISA applications with reactivity to human, rat, pig samples 31924-1-AP targets ATL1 in WB, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: rat brain tissue, fetal human brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ATL1 encodes atlastin-1, a GTPase that plays a crucial role in maintaining the structure and function of the endoplasmic reticulum. Mutations in ATL1 are one of the most common causes of hereditary spastic paraplegia (HSP) (PMID: 38851544). tlastin-1 is regulated by ubiquitination, a post-translational modification that can affect its activity and localization. For example, the E3 ubiquitin ligase SYVN1 has been shown to ubiquitinate atlastin-1, inhibiting its GTPase activity and thereby affecting ER morphology (PMID: 32916628). Specification Tested Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29223 Product name: Recombinant human ATL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 449-558 aa of BC010708 Sequence: ATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM Predict reactive species Full Name: atlastin GTPase 1 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC010708 Gene Symbol: ATL1 Gene ID (NCBI): 51062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WXF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.