Proteintech, 31928-1-AP, CLEC2L Polyclonal antibody

Size: 20ul / 150ul The CLEC2L (31928-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC2L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31928-1-AP targets CLEC2L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse cerebellum tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C-type lectin domain family 2 member L (CLEC2L) is a membrane protein mainly expressed in brain tissue and probably has carbohydrate-binding activity. The CLEC2L-encoded C-type lectin-like receptors (CTLRs) are expressed as non-glycosylated, disulfide-linked homodimers at the cell surface, and designated as BACL (brain-associated C-type lectin) (PMID: 23776472). The CLEC2L protein has 214 amino acids with a predicted molecular mass of 23.9 kDa. Under non-reducing conditions, FLAG-tagged CLEC2L proteins appeared with a molecular mass of ~55 kDa in immunoblots because of the occurrence of disulfide-linked homodimers (PMID: 23776472). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35450 Product name: Recombinant human CLEC2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-214 aa of NM_001080511.2 Sequence: SKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT Predict reactive species Full Name: C-type lectin domain family 2, member L Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_001080511.2 Gene Symbol: CLEC2L Gene ID (NCBI): 154790 RRID: AB_3670148 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0C7M8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.