Proteintech, 31931-1-AP, SPINT3 Polyclonal antibody

Size: 20ul / 150ul The SPINT3 (31931-1-AP) by Proteintech is a Polyclonal antibody targeting SPINT3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31931-1-AP targets SPINT3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse testis tissue, A549 cells, mouse epididymis tissue, rat testis tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Serine peptidase inhibitor, Kunitz type 3 (SPINT3, also known as HKIB9) might be related to serine-type endopeptidase inhibitor activity, receptor antagonist activity, and transforming growth factor beta binding (PMID: 21988899). The calculated molecular weight of SPINT3 is 10 kDa, which is lower than its observed molecular weight of 30-35 kDa by SDS-PAGE detection (PMID: 21988899). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35289 Product name: Recombinant human SPINT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-89 aa of NM_006652.1 Sequence: RDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Predict reactive species Full Name: serine peptidase inhibitor, Kunitz type, 3 Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_006652.1 Gene Symbol: SPINT3 Gene ID (NCBI): 10816 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P49223 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.