Proteintech, 31942-1-AP, GSDMD Polyclonal antibody

Size: 20ul / 150ul The GSDMD (31942-1-AP) by Proteintech is a Polyclonal antibody targeting GSDMD in WB, ELISA applications with reactivity to mouse samples 31942-1-AP targets GSDMD in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: EL-4 cells, J774A.1 cells, NIH/3T3 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can only detect full-length GSDMD. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36922 Product name: Recombinant mouse Gsdmd protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of NM_026960.4 Sequence: MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNI Predict reactive species Full Name: gasdermin D Calculated Molecular Weight: 53kDa，487aa Observed Molecular Weight: 50-53 kDa GenBank Accession Number: NM_026960.4 Gene Symbol: Gsdmd Gene ID (NCBI): 69146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9D8T2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.