Product Description
Size: 20ul / 150ul
The CD90 (31949-1-AP) by Proteintech is a Polyclonal antibody targeting CD90 in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse, rat samples
31949-1-AP targets CD90 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples.
Tested Applications
Positive WB detected in: PC-12 cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: PC-12 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
CD90, also known as Thy1, is a 25-35 kDa protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
Specification
Tested Reactivity: mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species
Full Name: Thy-1 cell surface antigen
Calculated Molecular Weight: 18 kDa
Observed Molecular Weight: 25 kDa
GenBank Accession Number: NM_012673.2
Gene Symbol: Thy1
Gene ID (NCBI): 24832
RRID: AB_3670155
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P01830
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924