Proteintech, 31969-1-AP, NOP16 Polyclonal antibody

Size: 20ul / 150ul The NOP16 (31969-1-AP) by Proteintech is a Polyclonal antibody targeting NOP16 in WB, IF/ICC, ELISA applications with reactivity to human samples 31969-1-AP targets NOP16 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, Hela cells, K-562 cells, MCF-7 cells, Raji cells Positive IF/ICC detected in: A431 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NOP16, also known as HSPC111, is found in the intracellular protein complex. It is a ribosomal protein that is transcriptionally regulated by the oncogene c-Myc. NOP16 may be involved in the completion of ribosome synthesis, therefore, reduced NOP16 expression in cancer cells may block many biological processes. Studies indicate that NOP16 is highly expressed in more than 20 types of cancers, including colorectal, breast, and hepatocellular carcinoma, and is an important target for clinical treatment of related diseases. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36714 Product name: Recombinant human NOP16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC040106 Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE Predict reactive species Full Name: NOP16 nucleolar protein homolog (yeast) Observed Molecular Weight: 23 kDa GenBank Accession Number: BC040106 Gene Symbol: NOP16 Gene ID (NCBI): 51491 RRID: AB_3670160 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y3C1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.