Proteintech, 31971-1-AP, Teneurin-3 Polyclonal antibody

Size: 20ul / 150ul The Teneurin-3 (31971-1-AP) by Proteintech is a Polyclonal antibody targeting Teneurin-3 in WB, ELISA applications with reactivity to human, mouse samples 31971-1-AP targets Teneurin-3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Teneurin-3, also known as Ten-m3, Odz3, Ten-m/Odz3, is a ~300 kDa type II transmembrane glycoprotein that is a member of the teneurin/Ten-m/Odz family. Ten-m3 plays a critical role in regulating connectivity of the nervous system, particularly in axon pathfinding and synaptic organisation in the motor and visual system. Mutation in the TENM3/ODZ3 gene in humans has been associated with the eye condition, microphthalmia (PMID 22766609). TENM3 is expressed in adult and fetal brain, slightly lower levels in testis and ovary, and intermediate levels in all other peripheral tissues examined. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36331 Product name: Recombinant human ODZ3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2388-2540 aa of NM_001080477 Sequence: RNNNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIANEDCIKVAAVLNNAFYLENLHFT Predict reactive species Full Name: odz, odd Oz/ten-m homolog 3 (Drosophila) Calculated Molecular Weight: 300kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_001080477 Gene Symbol: ODZ3 Gene ID (NCBI): 55714 RRID: AB_3670162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.