Iright
BRAND / VENDOR: Proteintech

Proteintech, 31989-1-AP, ANP32E Polyclonal antibody

CATALOG NUMBER: 31989-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ANP32E (31989-1-AP) by Proteintech is a Polyclonal antibody targeting ANP32E in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 31989-1-AP targets ANP32E in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, DU 145 cells, HeLa cells, K-562 cells, MCF-7 cells Positive IHC detected in: mouse kidney tissue, human lung tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Acidic nuclear phosphoprotein 32 family member E (ANP32E) is a histone chaperone that removes H2A.Z from chromatin. ANP32E is implicated in many cellular processes, including chromatin modification and remodeling, gene regulation, protein phosphorylation, and regulation of intracellular trafficking, and contributes to early development and cancer metastasis in mammals. In addition, ANP32E is involved in tumor development and is highly expressed in pancreatic and thyroid cancer cells, and promotes tumorigenesis in gastric cancer (GC) cells by inducing NUF2 expression. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33772 Product name: Recombinant human ANP32E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-268 aa of BC003380 Sequence: EEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD* Predict reactive species Full Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member E Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC003380 Gene Symbol: ANP32E Gene ID (NCBI): 81611 RRID: AB_3670167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BTT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924