Iright
BRAND / VENDOR: Proteintech

Proteintech, 31992-1-AP, Cubilin Polyclonal antibody

CATALOG NUMBER: 31992-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cubilin (31992-1-AP) by Proteintech is a Polyclonal antibody targeting Cubilin in WB, ELISA applications with reactivity to human, mouse samples 31992-1-AP targets Cubilin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Cubilin (CUBN) acts as a receptor for intrinsic factor-vitamin B12 complexes. Cubulin is located within the epithelium of intestine and kidney. Mutations in CUBN may play a role in autosomal recessive megaloblastic anemia. Cubilin is an endocytic receptor which plays a role in lipoprotein, vitamin and iron metabolism by facilitating their uptake (PMID: 9572993). Cubilin Acts together with LRP2 to mediate endocytosis of high-density lipoproteins, GC, hemoglobin, ALB, TF and SCGB1A1, which also acts together with AMN to mediate endocytosis of the CBLIF-cobalamin complex (PMID: 14576052). There are multiple glycosylation sites on Cubilin. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35808 Product name: Recombinant human CUBN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2141-2280 aa of NM_001081 Sequence: PNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL Predict reactive species Full Name: cubilin (intrinsic factor-cobalamin receptor) Calculated Molecular Weight: 398kDa Observed Molecular Weight: 450 kDa GenBank Accession Number: NM_001081 Gene Symbol: CUBN Gene ID (NCBI): 8029 RRID: AB_3670168 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60494 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924