Iright
BRAND / VENDOR: Proteintech

Proteintech, 32028-1-AP, KIAA0196 Polyclonal antibody

CATALOG NUMBER: 32028-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KIAA0196 (32028-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA0196 in WB, ELISA applications with reactivity to human, mouse samples 32028-1-AP targets KIAA0196 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KIAA0196 is a core component of the WASH complex, an actin-regulating complex involved in intracellular trafficking, mitochondrial metabolism, and myelination. It plays a crucial role in maintaining the structural integrity of myofibrils and regulating cardiac function. Recent studies have identified KIAA0196 as a susceptibility gene for abnormal cardiac development. Mutations or reduced expression of KIAA0196 can lead to cardiac defects, such as enlarged hearts and myocardial contractile dysfunction (PMID: 32417190). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36916 Product name: Recombinant human KIAA0196 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1159 aa of NM_014846.3 Sequence: KVGQMQILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPTDPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQKIPEIPADVVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRTVL Predict reactive species Full Name: KIAA0196 Calculated Molecular Weight: 134kDa,1159aa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_014846.3 Gene Symbol: KIAA0196 Gene ID (NCBI): 9897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q12768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924