Iright
BRAND / VENDOR: Proteintech

Proteintech, 32043-1-AP, NDFIP2 Polyclonal antibody

CATALOG NUMBER: 32043-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NDFIP2 (32043-1-AP) by Proteintech is a Polyclonal antibody targeting NDFIP2 in WB, ELISA applications with reactivity to human samples 32043-1-AP targets NDFIP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information NDFIP2 (Nedd4 family interacting protein 2) is a gene encoding a membrane-anchored adapter protein involved in a variety of cellular processes. It regulates protein ubiquitination and degradation by binding to the Nedd4 family of E3 ubiquitin ligases.NDFIP2 has a wide intracellular distribution, including the Golgi, mitochondria, and perinuclear region of the cytoplasm. Its function involves negative regulation of gene expression, negative regulation of protein transport, and positive regulation of protein ubiquitination. In addition, NDFIP2 is associated with a variety of diseases, such as supratentorial ventricular meningiomas in children. In the cardiovascular field, NDFIP2 affects cardiac electrophysiologic function by regulating the degradation of hERG potassium channels. It is also involved in the immune response, affecting T cell function by regulating cytokine signaling pathways. In oncology, NDFIP2 has been found to affect the antiviral response by targeting IFITM3. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36480 Product name: Recombinant human NDFIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of NM_019080.2 Sequence: MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFS Predict reactive species Full Name: Nedd4 family interacting protein 2 Calculated Molecular Weight: 36kDa,336aa Observed Molecular Weight: 39 kDa GenBank Accession Number: NM_019080.2 Gene Symbol: NDFIP2 Gene ID (NCBI): 54602 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NV92 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924