Iright
BRAND / VENDOR: Proteintech

Proteintech, 32058-1-AP, CSF2RA/CD116 Polyclonal antibody

CATALOG NUMBER: 32058-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CSF2RA/CD116 (32058-1-AP) by Proteintech is a Polyclonal antibody targeting CSF2RA/CD116 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 32058-1-AP targets CSF2RA/CD116 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, rat lung tissue Positive IHC detected in: mouse lung tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CD116, also named as CSF2RA CDw116 CSF2RAX CSF2RAY CSF2RX CSF2RY GM-CSF-R-alpha GMCSFR and GMR, is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CD116 transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2016 Product name: Recombinant Mouse CSF2RA/CD116 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-327 aa of NM_009970.2 Sequence: LLAPTTPDAGSALNLTFDPWTRTLTWACDTAAGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSFVNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGDDVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSHCTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAGDTRMKHWGEWSPAHPLEAEDTRVP Predict reactive species Full Name: colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) Calculated Molecular Weight: 42kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: NM_009970.2 Gene Symbol: CSF2RA/CD116 Gene ID (NCBI): 12982 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q00941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924