Iright
BRAND / VENDOR: Proteintech

Proteintech, 32063-1-AP, FBXO16 Polyclonal antibody

CATALOG NUMBER: 32063-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXO16 (32063-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO16 in WB, IP, ELISA applications with reactivity to human samples 32063-1-AP targets FBXO16 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, T-47D cells Positive IP detected in: T-47D cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information FBXO16 is a member of the F-box protein family, which functions as a substrate recognition subunit of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. High expression levels of FBXO16 are associated with better prognosis in cancer patients. For example, in ovarian cancer, patients with higher FBXO16 expression tend to have a more favorable outcome (PMID: 34333526). This suggests that FBXO16 could serve as a potential biomarker for cancer prognosis and therapeutic targeting. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36230 Product name: Recombinant human FBXO16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC074986 Sequence: MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP Predict reactive species Full Name: F-box protein 16 Calculated Molecular Weight: 292 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC074986 Gene Symbol: FBXO16 Gene ID (NCBI): 157574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IX29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924