Proteintech, 32069-1-AP, SLC66A2 Polyclonal antibody

Size: 20ul / 150ul The SLC66A2 (32069-1-AP) by Proteintech is a Polyclonal antibody targeting SLC66A2 in WB, ELISA applications with reactivity to human, mouse samples 32069-1-AP targets SLC66A2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SLC66A2 is a member of the solute carrier (SLC) family, which plays a significant role in the transport of a variety of molecules across cell and organelle membranes. SLC66A2 is predicted to be involved in phospholipid translocation and retrograde transport, specifically from the endosome to the Golgi apparatus. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34417 Product name: Recombinant human SLC66A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-231 aa of BC030140 Sequence: PQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFS Predict reactive species Full Name: Solute carrier family 66 member 2 Calculated Molecular Weight: 30 kDa, 271 aa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC030140 Gene Symbol: PQLC1 Gene ID (NCBI): 80148 RRID: AB_3670184 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N2U9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.