Iright
BRAND / VENDOR: Proteintech

Proteintech, 32085-1-AP, PAK7 Polyclonal antibody

CATALOG NUMBER: 32085-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PAK7 (32085-1-AP) by Proteintech is a Polyclonal antibody targeting PAK7 in WB, ELISA applications with reactivity to human, rat samples 32085-1-AP targets PAK7 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information PAK7, also known as PAK5, is a newly found but scarcely researched type II PAKs (PAK4, 5, 6). PAK7 was originally found in the brain, which promotes filopodia formation in nerve cells. Recently, studies have found that the expression level of PAK7 significantly increased in colorectal cancer, ovarian cancer, gastric cancer, neuroglioma, hepatocellular carcinoma, pancreatic cancer, osteosarcoma, and breast cancer. PAK7 plays an important role in tumorigenesis, invasion, and metastasis, mainly related to its mechanism of regulating cytoskeleton, inhibiting apoptosis, and promoting proliferation. The calculated molecular weight of PAK7 is 80 kDa (PMID: 29805709, PMID: 34165002). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29190 Product name: Recombinant human PAK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-360 aa of BC024179 Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS Predict reactive species Full Name: p21 protein (Cdc42/Rac)-activated kinase 7 Calculated Molecular Weight: 719 aa, 81 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC024179 Gene Symbol: PAK7 Gene ID (NCBI): 57144 RRID: AB_3670187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P286 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924