Proteintech, 32100-1-AP, C2orf69 Polyclonal antibody

Size: 20ul / 150ul The C2orf69 (32100-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf69 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 32100-1-AP targets C2orf69 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse stomach tissue, rat stomach tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Chromosome 2 open reading frame 69 (C2orf69, also known as COXPD53) is located in the mitochondrion. It can affect mitochondrial membrane potential and oxidative respiration in cultured neurons and controls the levels of the glycogen branching enzyme 1 (GBE1) (PMID: 34038740; 33945503). The variant in C2orf69 probably causes developmental regression, seizures, microcephaly, autistic features, and hypertonia (PMID: 37337918). Its deficiency can disrupt the development and homeostasis of the immune and central nervous systems (PMID: 34038740). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36779 Product name: Recombinant human C2orf69 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-385 aa of BC036456 Sequence: SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF Predict reactive species Full Name: chromosome 2 open reading frame 69 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC036456 Gene Symbol: C2orf69 Gene ID (NCBI): 205327 RRID: AB_3670190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N8R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.