Iright
BRAND / VENDOR: Proteintech

Proteintech, 32101-1-AP, RWDD4A Polyclonal antibody

CATALOG NUMBER: 32101-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RWDD4A (32101-1-AP) by Proteintech is a Polyclonal antibody targeting RWDD4A in WB, ELISA applications with reactivity to human samples 32101-1-AP targets RWDD4A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 5637 cells, SH-SY5Y cells, U-251 cells, U-87MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RWDD4, which is a poorly characterized gene that encodes the protein RWD Domain Containing 4, with an RWD domain being involved in protein-protein interactions (PMID: 27916600). RWDD4 was revealed to be a miR506 target in BCa cells, and the downregulation of RWDD4 was found to suppress BCa cell proliferation, migration and invasion (PMID: 30655740). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36777 Product name: Recombinant human RWDD4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC107432 Sequence: MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQFMENHNPINSATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE Predict reactive species Full Name: RWD domain containing 4A Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC107432 Gene Symbol: RWDD4A Gene ID (NCBI): 201965 RRID: AB_3670191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6NW29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924