Proteintech, 32104-1-AP, SPATA5 Polyclonal antibody

Size: 20ul / 150ul The SPATA5 (32104-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA5 in WB, ELISA applications with reactivity to human samples 32104-1-AP targets SPATA5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: RT-4 cells, HEK-293T cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information AAA+ ATPases SPATA5 is an ATP-dependent chaperone part of the 55LCC heterohexameric ATPase complex which is chromatin-associated and promotes replisome proteostasis to maintain replication fork progression and genome stability (PubMed:38554706). SPATA5 plays an essential role in the cytoplasmic maturation steps of pre-60S ribosomal particles by promoting the release of shuttling protein RSL24D1/RLP24 from the pre-ribosomal particles (PubMed:35354024, PubMed:38554706). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36838 Product name: Recombinant human SPATA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-300 aa of BC048217 Sequence: WPMAGFPGGKVGLSEMAQKNVGVRPGDAIQVQPLVGAVLQAEEMDVALSDKDMEINEEELTGCILRKLDGKIVLPGNFLYCTFYGRPYKLQVLRVKGADGMILGGPQSDSDTDAQRMAFEQSSMETSSLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNE Predict reactive species Full Name: spermatogenesis associated 5 Calculated Molecular Weight: 97, 86, 75 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC048217 Gene Symbol: SPATA5 Gene ID (NCBI): 166378 RRID: AB_3670193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NB90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.