Iright
BRAND / VENDOR: Proteintech

Proteintech, 32111-1-AP, LRRC45 Polyclonal antibody

CATALOG NUMBER: 32111-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LRRC45 (32111-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC45 in WB, IF/ICC, ELISA applications with reactivity to human samples 32111-1-AP targets LRRC45 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, HEK-293 cells, U2OS cells Positive IF/ICC detected in: A431 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The Leucine-Rich Repeat-Containing 45 (LRRC45) gene, a relatively unexplored entity in the realm of genomic studies, has recently garnered attention for its potential role in cellular processes and disease pathogenesis. Characterized by its leucine-rich repeats, a motif known for facilitating protein-protein interactions, LRRC45 is implicated in various cellular functions, including signal transduction and intracellular trafficking. LRRC45 promotes lung cancer proliferation and progression by enhancing c-MYC, Slug, MMP2, and MMP9 expression (PMID: 39326735). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36776 Product name: Recombinant human LRRC45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-512 aa of BC014109 Sequence: ERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERLDMEKRRCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKAKSQARLEEQQRLAHLEDKLRLL Predict reactive species Full Name: leucine rich repeat containing 45 Calculated Molecular Weight: 76 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC014109 Gene Symbol: LRRC45 Gene ID (NCBI): 201255 RRID: AB_3670195 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96CN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924