Iright
BRAND / VENDOR: Proteintech

Proteintech, 32122-1-AP, MTHFSD Polyclonal antibody

CATALOG NUMBER: 32122-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MTHFSD (32122-1-AP) by Proteintech is a Polyclonal antibody targeting MTHFSD in WB, ELISA applications with reactivity to human samples 32122-1-AP targets MTHFSD in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HaCaT cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information MTHFSD is an RNA-binding protein that contains a methyltetrahydrofolate synthase structural domain and an RRM structural domain. In healthy motor neurons, MTHFSD is predominantly located in the nucleus, and studies have shown that MTHFSD, as a novel marker of stress granules, may be associated with aggregated proteins involved in amyotrophic lateral sclerosis (ALS). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37100 Product name: Recombinant human MTHFSD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC112059 Sequence: MEPRAVGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARTQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNYSVPIGLDSRVLVDLVVVGSVAVSEKGWRIGKGEGYADLEYAMMVSMGAVSKETPVVTIVHDCQVVDIPEELVEEHDIT Predict reactive species Full Name: methenyltetrahydrofolate synthetase domain containing Observed Molecular Weight: 45 kDa GenBank Accession Number: BC112059 Gene Symbol: MTHFSD Gene ID (NCBI): 64779 RRID: AB_3670199 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q2M296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924