Proteintech, 32144-1-AP, CD3 Delta Polyclonal antibody

Size: 20ul / 150ul The CD3 Delta (32144-1-AP) by Proteintech is a Polyclonal antibody targeting CD3 Delta in WB, IHC, IF-P, ELISA applications with reactivity to human samples 32144-1-AP targets CD3 Delta in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2288 Product name: Recombinant Human CD3 delta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-105 aa of BC070321 Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA Predict reactive species Full Name: CD3d molecule, delta (CD3-TCR complex) Calculated Molecular Weight: 171 aa, 19 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC070321 Gene Symbol: CD3 Delta Gene ID (NCBI): 915 RRID: AB_3670206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P04234 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.