Iright
BRAND / VENDOR: Proteintech

Proteintech, 32165-1-AP, TNRC18 Polyclonal antibody

CATALOG NUMBER: 32165-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TNRC18 (32165-1-AP) by Proteintech is a Polyclonal antibody targeting TNRC18 in WB, ELISA applications with reactivity to human, mouse samples 32165-1-AP targets TNRC18 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BxPC-3 cells, HepG2 cells, MDA-MB-453 cells, mouse kidney tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Trinucleotide repeat containing 18 (TNRC18, also known as CAGL79 and KIAA1856) is a nucleic-acid-binding protein, which recognizes H3K9me3 to mediate the silencing of ERV class I (ERV1) elements and acts as a chromatin-associated regulator of ERVs (PMID: 27980689; 37938770). It is located in the cytosol, mitochondrion, and nucleus (PMID: 19262598). The mutation in TNRC18 may cause Fazio-Londe disease (PMID: 38188848). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37483 Product name: Recombinant human TNRC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1238-1400 aa of BC131808 Sequence: PCTAALDLGVQLTPETLVEAKEEPVEVPVAVPVVEAVPEEGLAQVAPSESQPTLEMSDCDVPAGEGQCPSLEPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLPSPGAAGAQALEKLEAAESLVLEQSFLHGITLLSEIAELELER Predict reactive species Full Name: trinucleotide repeat containing 18 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC131808 Gene Symbol: TNRC18 Gene ID (NCBI): 84629 RRID: AB_3670212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O15417 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924