Iright
BRAND / VENDOR: Proteintech

Proteintech, 32178-1-AP, HMCN2 Polyclonal antibody

CATALOG NUMBER: 32178-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HMCN2 (32178-1-AP) by Proteintech is a Polyclonal antibody targeting HMCN2 in WB, IP, ELISA applications with reactivity to human samples 32178-1-AP targets HMCN2 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells Positive IP detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information HMCN2 (Hemicentin-2) is a large extracellular matrix protein belonging to the fibronectin family. HMCN2 proteins form a complex network of microfibrils in the extracellular matrix that is essential for the maintenance of tissue structure and function. HMCN2 is expressed in epithelial cells and muscle tissues, and may play an important role in muscle-tendon attachment. HMCN2 expression and localization suggests that it has an important role in maintaining the integrity of skin and muscle tissue. It may maintain tissue structure and function by interacting with other extracellular matrix proteins, such as fibronectin and elastic fibers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37696 Product name: Recombinant human HMCN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-536 aa of XM_011518465.3 Sequence: TLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHEGNPLLRVSGVSYSGVAPGAPLVSMAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEERHFQESGNSSWEILRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLS Predict reactive species Full Name: hemicentin 2 Calculated Molecular Weight: 542kDa,5059aa Observed Molecular Weight: 550 kDa GenBank Accession Number: XM_011518465.3 Gene Symbol: HMCN2 Gene ID (NCBI): 256158 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NDA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924