Proteintech, 32179-1-AP, TOM1L2 Polyclonal antibody

Size: 20ul / 150ul The TOM1L2 (32179-1-AP) by Proteintech is a Polyclonal antibody targeting TOM1L2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32179-1-AP targets TOM1L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A-253 cells, BxPC-3 cells, HaCaT cells, LNCaP cells, U-251 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Target of Myb-like protein 2 (TOM1L2) acts as a MYO6/Myosin VI adapter protein that targets myosin VI to endocytic structures (PMID: 23023224). It may play a role in recruiting clathrin to endosomes and regulating growth factor-induced mitogenic signaling (PMID: 16412388; 16479011). TOM1L2 also regulates membrane trafficking that is linked to immunity and cell proliferation (PMID: 20604899). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37612 Product name: Recombinant human TOM1L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-457 aa of NM_001082968.1 Sequence: LRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTS Predict reactive species Full Name: target of myb1-like 2 (chicken) Calculated Molecular Weight: 56 kDa，507aa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_001082968.1 Gene Symbol: TOM1L2 Gene ID (NCBI): 146691 RRID: AB_3670215 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZVM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.