Proteintech, 32190-1-AP, CCL3/MIP-1 alpha Polyclonal antibody

Size: 20ul / 150ul The CCL3/MIP-1 alpha (32190-1-AP) by Proteintech is a Polyclonal antibody targeting CCL3/MIP-1 alpha in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 32190-1-AP targets CCL3/MIP-1 alpha in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LPS and Brefeldin A treated RAW 264.7 cells Positive IF/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2170 Product name: Recombinant Mouse CCL3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011337 Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Predict reactive species Full Name: chemokine (C-C motif) ligand 3 Calculated Molecular Weight: 10kd Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_011337 Gene Symbol: Ccl3 Gene ID (NCBI): 20302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P10855 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.