Proteintech, 32194-1-AP, PPPDE2 Polyclonal antibody

Size: 20ul / 150ul The PPPDE2 (32194-1-AP) by Proteintech is a Polyclonal antibody targeting PPPDE2 in WB, ELISA applications with reactivity to human samples 32194-1-AP targets PPPDE2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, MDA-MB-453 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PPPDE2 belongs to N1pC/P60 superfamily of papain-like enzymes, which comprise an extremely diverse group of proteins originating from archaea, bacteria, bacteriophages, viruses, and eukaryotes with predicted protease, amidase, transglutaminases, or acyltransferase activity but often uncharacterized function (PMID: 12620121). PPPDE2 exhibits palmitoyl protein thioesterase (S-depalmitoylation) activity towards synthetic substrates 4-methylumbelliferyl-6-S-palmitoyl-beta-D-glucopyranoside and S-depalmitoylation probe 5 (DPP-5) (PMID:35427157). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37655 Product name: Recombinant human PPPDE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC112179 Sequence: MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS Predict reactive species Full Name: PPPDE peptidase domain containing 2 Calculated Molecular Weight: 168 aa, 18 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC112179 Gene Symbol: PPPDE2 Gene ID (NCBI): 27351 RRID: AB_3670220 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ICB0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.