Iright
BRAND / VENDOR: Proteintech

Proteintech, 32225-1-AP, SEC24B Polyclonal antibody

CATALOG NUMBER: 32225-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SEC24B (32225-1-AP) by Proteintech is a Polyclonal antibody targeting SEC24B in WB, ELISA applications with reactivity to human samples 32225-1-AP targets SEC24B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information SEC24B is a gene that encodes a protein belonging to the SEC23/SEC24 family, which is involved in vesicle trafficking. The protein is thought to be a cargo-binding component of the COPII vesicle and is involved in the transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36544 Product name: Recombinant human SEC24B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-250 aa of NM_006323.4 Sequence: QNVTPNTVNQQPGAQQLYSRGPPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPLPPLPSQQHHQ Predict reactive species Full Name: SEC24 family, member B (S. cerevisiae) Calculated Molecular Weight: 137kDa,1268aa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_006323.4 Gene Symbol: SEC24B Gene ID (NCBI): 10427 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924