Proteintech, 32243-1-AP, GPR183/EBI2 Polyclonal antibody

Size: 20ul / 150ul The GPR183/EBI2 (32243-1-AP) by Proteintech is a Polyclonal antibody targeting GPR183/EBI2 in WB, ELISA applications with reactivity to human, mouse, rat samples 32243-1-AP targets GPR183/EBI2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information G-protein-coupled receptor 183, also known as Epstein-Barr virus-induced gene 2 (EBI2), was initially identified in B cells and is the most upregulated gene after infection with Epstein-Barr virus (PMID:37353188). GPR183 is known to play a key role in the development of antibody responses in secondary lymphoid organs (PMID:23473835). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36765 Product name: Recombinant human GPR183 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 313-361 aa of BC020752 Sequence: KGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQMMIHSKSSNGK Predict reactive species Full Name: G protein-coupled receptor 183 Calculated Molecular Weight: 361 aa, 41 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC020752 Gene Symbol: EBI2 Gene ID (NCBI): 1880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P32249 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.