Iright
BRAND / VENDOR: Proteintech

Proteintech, 32248-1-AP, SORCS3 Polyclonal antibody

CATALOG NUMBER: 32248-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SORCS3 (32248-1-AP) by Proteintech is a Polyclonal antibody targeting SORCS3 in WB, ELISA applications with reactivity to human, mouse, rat samples 32248-1-AP targets SORCS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SK-N-SH cells, IMR-32 cells. SH-SY5Y cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Sortilin related VPS10 domain-containing receptor 3 (SorCS3) belongs to the vacuolar protein sorting 10 protein (VPS10p) receptor family. SorCS3 is a specific receptor for nerve growth factor (NGF) that regulates NGF signal transduction across membranes, and SorCS3 is mainly expressed in the hippocampus and cortex of the brain (PMID: 35393432). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37710 Product name: Recombinant human SORCS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-190 aa of NM_014978.2 Sequence: EITWDATGGPGRPAAPASRPPALSPLSPRAVASQWPEELASARRAAVLGRRAGPELLPQQGGGRGGEMQVEAGGTSPAGERRGRGIPAPAKLGGARRSRRAQPPITQERGDAWATAPADGSRGSRPLAKGSREEVKAPRAGGSAAEDLRLPSTSFAL Predict reactive species Full Name: sortilin-related VPS10 domain containing receptor 3 Calculated Molecular Weight: 136kDa,1222aa Observed Molecular Weight: 160 kDa GenBank Accession Number: NM_014978.2 Gene Symbol: SORCS3 Gene ID (NCBI): 22986 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UPU3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924