Product Description
Size: 20ul / 150ul
The SLC35F4 (32258-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35F4 in WB, ELISA applications with reactivity to human samples
32258-1-AP targets SLC35F4 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells, Caco-2 cells, HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34518 Product name: Recombinant human SLC35F4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-521 aa of NM_001206920 Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA Predict reactive species
Full Name: solute carrier family 35, member F4
Calculated Molecular Weight: 521 aa, 58 kDa
Observed Molecular Weight: 42 kDa, 65 kDa
GenBank Accession Number: NM_001206920
Gene Symbol: SLC35F4
Gene ID (NCBI): 341880
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: A4IF30
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924