Proteintech, 32258-1-AP, SLC35F4 Polyclonal antibody

Size: 20ul / 150ul The SLC35F4 (32258-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35F4 in WB, ELISA applications with reactivity to human samples 32258-1-AP targets SLC35F4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, Caco-2 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34518 Product name: Recombinant human SLC35F4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-521 aa of NM_001206920 Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA Predict reactive species Full Name: solute carrier family 35, member F4 Calculated Molecular Weight: 521 aa, 58 kDa Observed Molecular Weight: 42 kDa, 65 kDa GenBank Accession Number: NM_001206920 Gene Symbol: SLC35F4 Gene ID (NCBI): 341880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A4IF30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.