Iright
BRAND / VENDOR: Proteintech

Proteintech, 32262-1-AP, MYOM2 Polyclonal antibody

CATALOG NUMBER: 32262-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MYOM2 (32262-1-AP) by Proteintech is a Polyclonal antibody targeting MYOM2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32262-1-AP targets MYOM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue, mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Myomesin proteins comprise three family members encoded by MYOM1, MYOM2 and MYOM3, and localize to the M-band of the sarcomere. These three myomesin isoforms correlate with the contractile properties in different fiber types. MYOM1 is expressed in all striated muscles, whereas MYOM2 is expressed in the adult heart and fast fibers, and MYOM3 is expressed only in skeletal muscle intermediate fiber types (PMID:14609030;26792323;15890201). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35659 Product name: Recombinant human MYOM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_003970.3 Sequence: MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEP Predict reactive species Full Name: myomesin (M-protein) 2, 165kDa Calculated Molecular Weight: 165kDa,1465aa Observed Molecular Weight: 165 kDa GenBank Accession Number: NM_003970.3 Gene Symbol: MYOM2 Gene ID (NCBI): 9172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P54296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924