Iright
BRAND / VENDOR: Proteintech

Proteintech, 32272-1-AP, Proenkephalin-A Polyclonal antibody

CATALOG NUMBER: 32272-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Proenkephalin-A (32272-1-AP) by Proteintech is a Polyclonal antibody targeting Proenkephalin-A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32272-1-AP targets Proenkephalin-A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, human heart tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Proenkephalin-A (PENK) is also named as Synenkephalin, Met-enkephalin and Opioid growth factor (OGF), and belongs to the opioid neuropeptide precursor family. PENK is a neuropeptide that competes with and mimics the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress (PMID:7057924). PENK hypermethylation is also associated with bladder cancer, hepatocellular carcinoma, colorectal cancer, and prostate cancer (PMID:36403035). Proenkephalin (PENK) represents a new candidate to determine kidney function. This peptide is cleaved from the precursor peptide preproenkephalin A alongside enkephalins (endogenous opioids) and is filtrated in the glomerulus (PMID: 33636859). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27972 Product name: Recombinant human PENK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-267 aa of BC032505 Sequence: YGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF Predict reactive species Full Name: proenkephalin Calculated Molecular Weight: 267 aa, 31 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC032505 Gene Symbol: Proenkephalin A Gene ID (NCBI): 5179 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924