Iright
BRAND / VENDOR: Proteintech

Proteintech, 32281-1-AP, HLA-DQB1 Polyclonal antibody

CATALOG NUMBER: 32281-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HLA-DQB1 (32281-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DQB1 in WB, IHC, ELISA applications with reactivity to human samples 32281-1-AP targets HLA-DQB1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The HLA-DQB1 gene is part of the human leukocyte antigen (HLA) complex, which is involved in the immune system's ability to distinguish the body's own proteins from those made by foreign invaders such as viruses and bacteria. It belongs to the MHC class II genes, which provide instructions for making proteins present on the surface of certain immune system cells. These proteins attach to protein fragments (peptides) outside the cell and display them to the immune system. If the immune system recognizes the peptides as foreign, it triggers a response to attack the invading pathogens. . Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34755 Product name: Recombinant human HLA-DQB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-230 aa of BC012106 Sequence: RDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQSESAQSK Predict reactive species Full Name: major histocompatibility complex, class II, DQ beta 1 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012106 Gene Symbol: HLA-DQB1 Gene ID (NCBI): 3119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01920 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924