Proteintech, 32289-1-AP, TEKTIP1 Polyclonal antibody

Size: 20ul / 150ul The TEKTIP1 (32289-1-AP) by Proteintech is a Polyclonal antibody targeting TEKTIP1 in WB, ELISA applications with reactivity to human, mouse samples 32289-1-AP targets TEKTIP1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TEKTIP1, a functionally unknown protein, is proposed to be localized at the center of the tektin bundle. Tektip1-knockout mice were male subfertile due to a disruption in sperm motility. The waveform of sperm flagella and ultrastructure of axonemes were moderately altered after the loss of TEKTIP1 (38448737). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37761 Product name: Recombinant human TEKTIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of NM_001135580 Sequence: MQTLRQEAARPCIPSGTLEASFPAPLYSDDYLSLEGSRWPPAIRQATRWKYTPMGRDAAGQLWYTGLTNSDAWEAWYNLPRAPASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPIRGKEYVLNRNRYGVEPLWRASDYVPSLSAPQRPPGTTQNYREWVLEPYCPSTCQRSPPSLTPTPR Predict reactive species Full Name: chromosome 19 open reading frame 71 Calculated Molecular Weight: 209aa, 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: NM_001135580 Gene Symbol: C19orf71 Gene ID (NCBI): 100128569 RRID: AB_3670232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NCJ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.