Iright
BRAND / VENDOR: Proteintech

Proteintech, 32316-1-AP, HEATR5B Polyclonal antibody

CATALOG NUMBER: 32316-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HEATR5B (32316-1-AP) by Proteintech is a Polyclonal antibody targeting HEATR5B in WB, ELISA applications with reactivity to human samples 32316-1-AP targets HEATR5B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, U-251 cells, RT-4 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information HEATR5B (HEAT Repeat Containing 5B) is a protein containing HEAT repeat that binds directly to the dynein tail and dynactin and has an evolutionarily conserved function in promoting the motility of adaptor protein-1 (AP1)-associated endosomal membranes (PMID: 37872872). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36352 Product name: Recombinant human HEATR5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 700-850 aa of BC150605 Sequence: FTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPEEVR Predict reactive species Full Name: HEAT repeat containing 5B Observed Molecular Weight: ~210 kDa GenBank Accession Number: BC150605 Gene Symbol: HEATR5B Gene ID (NCBI): 54497 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P2D3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924