Proteintech, 32331-1-AP, DLL4 Polyclonal antibody

Size: 20ul / 150ul The DLL4 (32331-1-AP) by Proteintech is a Polyclonal antibody targeting DLL4 in WB, ELISA applications with reactivity to human, mouse samples 32331-1-AP targets DLL4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, mouse brain tissue, mouse kidney tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DLL4, also named as Delta4, plays a role in the Notch signaling pathway. It activates Notch-1 and Notch-4. Notch signaling is activated upon engagement of the Notch receptor with its ligands, the DSL (Delta, Serrate, Lag2) proteins of single-pass type I membrane proteins. DLL4 is highly expressed in the vascular endothelium and is involved in angiogenesis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34664 Product name: Recombinant human DLL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-275 aa of BC106950 Sequence: EAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEG Predict reactive species Full Name: delta-like 4 (Drosophila) Calculated Molecular Weight: 685 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC106950 Gene Symbol: DLL4 Gene ID (NCBI): 54567 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.