Product Description
Size: 20ul / 150ul
The Ly-6G (32346-1-AP) by Proteintech is a Polyclonal antibody targeting Ly-6G in WB, FC, ELISA applications with reactivity to mouse samples
32346-1-AP targets Ly-6G in WB, IF, FC, ELISA applications and shows reactivity with mouse samples.
Tested Applications
Positive WB detected in: mouse bone marrow
Positive FC detected in: mouse bone marrow cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).
Specification
Tested Reactivity: mouse
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Eg2609 Product name: Recombinant Mouse Ly6g protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species
Full Name: lymphocyte antigen 6 complex, locus G
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 20-30 kDa
GenBank Accession Number: NM_001310438.1
Gene Symbol: Ly-6G
Gene ID (NCBI): 546644
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P35461
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924